Proteintech, 34038-1-AP, CMTM1 Polyclonal antibody

Size: 20ul / 150ul The CMTM1 (34038-1-AP) by Proteintech is a Polyclonal antibody targeting CMTM1 in WB, ELISA applications with reactivity to human, mouse, rat samples 34038-1-AP targets CMTM1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information CMTM1 is a MARVEL domain-containing membrane protein enriched in testis and epithelial tissues, with emerging roles in membrane trafficking and cell survival. Its frequent overexpression in multiple cancers and association with aggressive tumor behavior suggest that CMTM1 contributes to tumor progression, potentially by modulating membrane organization or receptor signaling. These properties position CMTM1 as a candidate biomarker and functional regulator in cancer biology (PMID: 33585698, 31542285). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag40585 Product name: Recombinant human CMTM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 237-286 aa of BC057852 Sequence: VIVCCIDAFVVTTKMRTNLKRFLGVEVERKLSPAKDAYPETGPDAPQRPA Predict reactive species Full Name: CKLF-like MARVEL transmembrane domain containing 1 Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC057852 Gene Symbol: CMTM1 Gene ID (NCBI): 113540 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8IZ96 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.