Iright
BRAND / VENDOR: Proteintech

Proteintech, 34062-1-AP, RIPK1 Polyclonal antibody

CATALOG NUMBER: 34062-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RIPK1 (34062-1-AP) by Proteintech is a Polyclonal antibody targeting RIPK1 in WB, ELISA applications with reactivity to human, mouse samples 34062-1-AP targets RIPK1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: K-562 cells, MCF-7 cells, MDA-MB-231 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag39986 Product name: Recombinant mouse RIPK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-290 aa of NM_009068 Sequence: MQPDMSLDNIKMASSDLLEKTDLDSGGFGKVSLCYHRSHGFVILKKVYTGPNRAEYNEVLLEEGKMMHRLRHSRVVKLLGIIIEEGNYSLVMEYMEKGNLMHVLKTQIDVPLSLKGRIIVEAIEGMCYLHDKGVIHKDLKPENILVDRDFHIKIADLGVASFKTWSKLTKEKDNKQKEVSSTTKKNNGGTLYYMAPEHLNDINAKPTEKSDVYSFGIVLWAIFAKKEPYENVICTEQFVICIKSGNRPNVEEILEYCPREIISLMERCWQAIPEDRPTFLGIEEEFRPFY Predict reactive species Full Name: receptor (TNFRSF)-interacting serine-threonine kinase 1 Calculated Molecular Weight: 75 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: NM_009068 Gene Symbol: Ripk1 Gene ID (NCBI): 19766 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q60855 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924