Proteintech, 34093-1-AP, CLEC2/CLEC1B Polyclonal antibody

Size: 20ul / 150ul The CLEC2/CLEC1B (34093-1-AP) by Proteintech is a Polyclonal antibody targeting CLEC2/CLEC1B in WB, ELISA applications with reactivity to mouse samples 34093-1-AP targets CLEC2/CLEC1B in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information C-type lectin-like receptor 2 (CLEC2, also known as CLEC1B) is a type II transmembrane receptor of the C-type lectin superfamily, which are characterized by one or more C-type lectin-like domains (CTLDs) (PMID: 10671229; 34177942). CLEC2 contains a single YXXL/hemi-ITAM (immuno-receptor tyrosine-based activation motif) within its cytoplasmic domain. CLEC-2 is highly expressed on platelets and megakaryocytes and at low levels on other hematopoietic cells, including dendritic cells, neutrophils, monocytes, and macrophages (PMID: 21728173). The first identified ligand for CLEC2 was the platelet-aggregating snake venom protein rhodocytin, and podoplanin has been established as an endogenous ligand for CLEC2 (PMID: 26151067). CLEC2 is involved in thrombosis/hemostasis, tumor metastasis, and lymphangiogenesis (PMID: 20525685). CLEC2 can be glycosylated and has been detected as 32- and 40-kDa forms in platelets with varying degrees of glycosylation (PMID: 16174766; 25150298; 21781241). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg7521 Product name: Recombinant mouse CLEC-2 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 53-229 aa of NM_019985.3 Sequence: MSVTQQKYLLAEKENLSATLQQLAKKFCQELIRQSEIKTKSTFEHKCSPCATKWRYHGDSCYGFFRRNLTWEESKQYCTEQNATLVKTASQSTLDYIAERITSVRWIGLSRQNSKKDWMWEDSSVLRKNGINLSGNTEENMNCAYLHNGKIHPASCKERHYLICERNAGMTRVDQLL Predict reactive species Full Name: C-type lectin domain family 1, member b Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: NM_019985.3 Gene Symbol: Clec1b Gene ID (NCBI): 56760 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9JL99-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.