Iright
BRAND / VENDOR: Proteintech

Proteintech, 34174-1-AP, ZC3H7A Polyclonal antibody

CATALOG NUMBER: 34174-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ZC3H7A (34174-1-AP) by Proteintech is a Polyclonal antibody targeting ZC3H7A in WB, ELISA applications with reactivity to human samples 34174-1-AP targets ZC3H7A in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, L02 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information ZC3H7A (Zinc finger CCCH-type containing 7A, also known as HSPC055 or FLJ20318) is an RNA-binding protein containing zinc finger domains. This protein contains one C2H2-type zinc finger, three CCCH-type zinc fingers, and three TPR repeat sequences, belonging to the class III CCCH zinc finger protein family. ZC3H7A primarily functions in miRNA binding, where it recognizes miRNA hairpin sequences and participates in regulating miRNA biogenesis and processing. Research indicates that this protein plays a significant role in immune regulation: its expression is significantly upregulated upon macrophage activation, Th2 cell activation, and LPS stimulation, and it is enriched in immune organs such as the thymus and spleen. Notably, HIV vaccine studies have found that high expression of ZC3H7A is associated with decreased vaccine protective efficacy. Furthermore, genome-wide association studies suggest its correlation with QT interval duration, though the specific molecular mechanisms require further investigation. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag40239 Product name: Recombinant human ZC3H7A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-205 aa of NM_014153.3 Sequence: MSNVSEERRKRQQNIKEGLQFIQSPLSYPGTQEQYAVYLRALVRNLFNEGNDVYREHDWNNSISQYTEALNIADYAKSEEILIPKEIIEKLYINRIACYSNMGFHDKVLEDCNIVLSLNASNCKALYRKSKALSDLGRYKKAYDAVAKCSLAVPQDEHVIKLTQELAQKLGFKIRKAYVRAELSLKSVPGDGATKALNHSVEDIE Predict reactive species Full Name: zinc finger CCCH-type containing 7A Calculated Molecular Weight: 110kDa,971aa Observed Molecular Weight: 110 kDa GenBank Accession Number: NM_014153.3 Gene Symbol: ZC3H7A Gene ID (NCBI): 29066 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8IWR0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924