Iright
BRAND / VENDOR: Proteintech

Proteintech, 51027-2-AP, MECR Polyclonal antibody

CATALOG NUMBER: 51027-2-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MECR (51027-2-AP) by Proteintech is a Polyclonal antibody targeting MECR in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 51027-2-AP targets MECR in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, mouse skeletal muscle tissue, mouse stomach tissue, rat heart tissue Positive IP detected in: mouse heart tissue Positive IF/ICC detected in: C2C12 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Mitochondrial Trans-2-Enoyl-CoA Reductase is abbrivated as MECR, involved in human mitochonrial fatty acid synthesis(mtFAS) as an oxidoreductase. (PMID: 27817865) MECR has molecular weight can be calculated around 37KDa. With immunopercipitation reaction on mouse heart samples, the IgG heavy chain, dimer of MECR is around 65KDa. Numerous studies have shown disorder of lipid metabolism is closely related with malignance, especially in liver cancer. As futher research suggests that MECR has close realitionship with cell prolifereation, appotosis, and metastasis (PMID: 31178528) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, yeast Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0465 Product name: Recombinant mouse Mecr protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 117-373 aa of BC003864 Sequence: SSVSALKPGDWVIPANAGLGTWRTEAVFSEEALIGIPKDIPLQSAATLGVNPCTAYRMLVDFEQLQPGDSVIQNASNSGVGQAVIQIASALRLKTINVVRDRPDIKKLTDRLKDLGADYVLTEEELRMPETKTIFKDLPLPRLALNCVGGKSSTELLRHLAPGGTMVTYGGMAKQPVTASVSLLIFKDLKLRGFWLSQWKKNHSPDEFKELILTLCNLIRQGRLTAPSCSEVPLQGYQQALEASMKPFVSSKQILTM Predict reactive species Full Name: mitochondrial trans-2-enoyl-CoA reductase Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 37-40 kDa GenBank Accession Number: BC003864 Gene Symbol: MECR Gene ID (NCBI): 26922 RRID: AB_615013 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9DCS3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924