Iright
BRAND / VENDOR: Proteintech

Proteintech, 51029-2-AP, SSTR5 Polyclonal antibody

CATALOG NUMBER: 51029-2-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SSTR5 (51029-2-AP) by Proteintech is a Polyclonal antibody targeting SSTR5 in WB, ELISA applications with reactivity to human, mouse samples 51029-2-AP targets SSTR5 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2400 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0519 Product name: Recombinant human SSTR5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-54 aa of BC146576 Sequence: MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAG Predict reactive species Full Name: somatostatin receptor 5 Calculated Molecular Weight: 364 aa, 39 kDa Observed Molecular Weight: 50 kDa, 65 kDa GenBank Accession Number: BC146576 Gene Symbol: SSTR5 Gene ID (NCBI): 6755 RRID: AB_615039 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35346 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924