Proteintech, 51090-1-AP, VSP15a Polyclonal antibody

Size: 20ul / 150ul The VSP15a (51090-1-AP) by Proteintech is a Polyclonal antibody targeting VSP15a in ELISA applications with reactivity to yeast samples 51090-1-AP targets VSP15a in ELISA applications and shows reactivity with yeast samples. Background Information This antibody recoginize the SPAPB1A10 protein of Yeast. Specification Tested Reactivity: yeast Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0724 Product name: Recombinant yeast VSP15a protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-285 aa of CAC21478 Sequence: MKRQRPQDSMISVPLQNENSTTTPTKEVSHLNFPLKRPRLHSFVPTSKQAALSDITPDTPPAFKTPYSSLPYNLVPQNSSTSKKRPRAEDLLVIEPSQNSLVPSTQNNEWNEIARKRVSLESDHPDKSGQVIDLATGQILDKQTEDIDDDRNKSAVSKSLVRHPHRLKMLPFGIQSAHPYISSLNSNYPTTWHFASHYYPTDSKQLVKYHPTEVHPSWTVEEPVHYNTYDGVVNEPNSSVIIEELDDDYDELNDPMNNNDTPITNSTHSAQMSNLPTHDSMDID Predict reactive species Full Name: SPAPB1A10.05 Calculated Molecular Weight: 32 kDa GenBank Accession Number: CAC21478 Gene Symbol: SPAPB1A10.05 Gene ID (NCBI): 2543600 RRID: AB_2881244 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.