Proteintech, 51143-1-AP, Vpr Polyclonal antibody

Size: 20ul / 150ul The Vpr (51143-1-AP) by Proteintech is a Polyclonal antibody targeting Vpr in ELISA applications with reactivity to immunodeficiency virus 1 samples 51143-1-AP targets Vpr in WB, ELISA applications and shows reactivity with immunodeficiency virus 1 samples. Background Information This antibody recognize the VPR gene of Human immunodeficiency virus 1. Specification Tested Reactivity: immunodeficiency virus 1 Cited Reactivity: human, virus Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0718 Product name: Recombinant Vpr protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-96 aa of NP_057852 Sequence: MEQAPEDQGPQREPHNEWTLELLEELKNEAVRHFPRIWLHGLGQHIYETYGDTWAGVEAIIRILQQLLFIHFRIGCRHSRIGVTRQRRARNGASR Predict reactive species Full Name: Vpr Calculated Molecular Weight: 11 kDa GenBank Accession Number: NP_057852 RRID: AB_10695191 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.