Proteintech, 51149-1-AP, TMPRSS3 Polyclonal antibody

Size: 20ul / 150ul The TMPRSS3 (51149-1-AP) by Proteintech is a Polyclonal antibody targeting TMPRSS3 in IHC, ELISA applications with reactivity to human, mouse samples 51149-1-AP targets TMPRSS3 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0443 Product name: Recombinant human TMPRSS3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-500 aa of BC074846 Sequence: MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFPIIVIGIIALILALAIGLGIHFDCSGKYRCRSSFKCIELIARCDGVSDCKDGEDEYRCVRVGGQNAVLQVFTAASWKTMCSDDWKGHYANVACAQLGFPSYVSSDNLRVSSLEGQFREEFVSIDHLLPDDKVTALHHSVYVREGCASGHVVTLQCTACGHRRGYSSRIVGGNMSLLSQWPWQASLQFQGYHLCGGSVITPLWIITAAHCVYDLYLPKSWTIQVGLVSLLDNPAPSHLVEKIVYHSKYKPKRLGNDIALMKLAGPLTFNEMIQPVCLPNSEENFPDGKVCWTSGWGATEDGGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLTGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRVTSFLDWIHEQMERDLKT Predict reactive species Full Name: transmembrane protease, serine 3 Calculated Molecular Weight: 453 aa, 49 kDa GenBank Accession Number: BC074846 Gene Symbol: TMPRSS3 Gene ID (NCBI): 64699 RRID: AB_2881253 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P57727 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.