Iright
BRAND / VENDOR: Proteintech

Proteintech, 60008-1-Ig, Beta Actin Monoclonal antibody

CATALOG NUMBER: 60008-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 150ul The Beta Actin (60008-1-Ig) by Proteintech is a Monoclonal antibody targeting Beta Actin in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat, zebrafish, plant samples 60008-1-Ig targets Beta Actin in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, zebrafish, plant samples. Tested Applications Positive WB detected in: multi-cells/tissue, HeLa cells, MCF-7 cells, HEK-293 cells, A549 cells, rice whole plant tissue, arabidopsis whole plant tissue Positive IHC detected in: mouse heart tissue, human brain tissue, human kidney tissue, human lung tissue, human ovary tissue, human placenta tissue, human spleen tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat brain tissue Positive IF/ICC detected in: MDCK cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Beta actin, also named as ACTB and F-Actin, belongs to the actin family. Actins are highly conserved globular proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. At least six isoforms of actins are known in mammals and other vertebrates: alpha (ACTC1, cardiac muscle 1), alpha 1 (ACTA1, skeletal muscle) and 2 (ACTA2, aortic smooth muscle), beta (ACTB), gamma 1 (ACTG1) and 2 (ACTG2, enteric smooth muscle). Beta and gamma 1 are two non-muscle actin proteins. Most actins consist of 376aa, while ACTG2 (rich in muscles) has 375aa and ACTG1(found in non-muscle cells) has only 374aa. Beta actin has been widely used as the internal control in RT-PCR and Western Blotting as a 42-kDa protein. However, the 37-40 kDa cleaved fragment of beta actin can be generated during apoptosis process. This antibody can recognize all the actins. Specification Tested Reactivity: human, mouse, rat, zebrafish, plant Cited Reactivity: human, rat, chicken, goat, yeast, tick, arabidopsis, terminalia bellirica, rare minnow, cat Host / Isotype: Mouse / IgM Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0297 Product name: Recombinant human beta actin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-167 aa of BC002409 Sequence: SGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYE Predict reactive species Full Name: actin, beta Calculated Molecular Weight: 375 aa, 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC002409 Gene Symbol: Beta Actin Gene ID (NCBI): 60 RRID: AB_2289225 Conjugate: Unconjugated Form: Liquid Purification Method: Caprylic acid/ammonium sulfate precipitation UNIPROT ID: P60709 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924