Iright
BRAND / VENDOR: Proteintech

Proteintech, 60024-1-Ig, S100A11 Monoclonal antibody

CATALOG NUMBER: 60024-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The S100A11 (60024-1-Ig) by Proteintech is a Monoclonal antibody targeting S100A11 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 60024-1-Ig targets S100A11 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: T-47D cells, A431 cells, BxPC-3 cells, DU 145 cells Positive IHC detected in: human lung cancer tissue, human ovary tumor tissue, human thyroid cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: BxPC-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:3000 Immunohistochemistry (IHC): IHC : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information S100A11, also named as MLN 70, Calgizzarin and S100C, belongs to the S-100 family. It facilitates the differentiation and the cornification of keratinocytes. The naming of S100A11 systematically arises from its membership of the S100 protein family, named after their solubility in 100% saturated ammonium sulfate solution. First discovered in 1989, S100A11 has since been proposed to have direct biological functions in an assortment of physiological processes such as endo- and exocytosis, regulation of enzyme activity, cell growth and regulation, apoptosis and inflammation. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0343 Product name: Recombinant human S100A11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 3-105 aa of BC001410 Sequence: KISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT Predict reactive species Full Name: S100 calcium binding protein A11 Calculated Molecular Weight: 105 aa, 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC001410 Gene Symbol: S100A11 Gene ID (NCBI): 6282 RRID: AB_2238821 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P31949 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924