Proteintech, 60044-1-Ig, Transgelin 2 Monoclonal antibody

Size: 20ul / 150ul The Transgelin 2 (60044-1-Ig) by Proteintech is a Monoclonal antibody targeting Transgelin 2 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse samples 60044-1-Ig targets Transgelin 2 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: K562 cells, A549 cells, HEK-293 cells, MCF-7 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human urothelial carcinoma tissue, human colon tissue, human colon cancer tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human colon cancer tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information The transgelin family is a group of proteins that belong to 22 kDa actin-related corpnin superfamily. Of all three isoforms, transgelin 1 is the best characterized. Transgelin 1, also known as SM22 alpha, is a specific marker for differentiated smooth muscle cells. Transgelin 2, also known as SM22 beta, is expressed by both smooth muscle and non-smooth muscle cells in a temporally and spatially regulated pattern. Trangenlin 3, also known as NP25, is only found in highly differentiated neuronal cells. Our test result showed that this antibody Is specific to TAGLN2. It does not bind TAGLN1 and TAGLN3. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0337 Product name: Recombinant human TAGLN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 4-130 aa of BC002616 Sequence: RGPAYGLSREVQQKIEKQYDADLEQILIQWITTQCRKDVGRPQPGRENFQNWLKDGTVLCELINAQYPEGQAPVKKIQASTMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWEGKNMACVQRTLM Predict reactive species Full Name: transgelin 2 Calculated Molecular Weight: 199 aa, 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC002616 Gene Symbol: Transgelin-2/TAGLN2 Gene ID (NCBI): 8407 RRID: AB_2271433 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P37802 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.