Proteintech, 60097-1-Ig, PCNA Monoclonal antibody

Size: 150ul The PCNA (60097-1-Ig) by Proteintech is a Monoclonal antibody targeting PCNA in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat, pig samples 60097-1-Ig targets PCNA in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, HeLa cells, Jurkat cells, K-562 cells, C6 cells, ROS1728 cells, NIH/3T3 cells, 3T3-L1 cells, 4T1 cells, RAW 264.7 cells Positive IP detected in: HepG2 cells Positive IHC detected in: human gliomas tissue, human breast cancer tissue, human liver cancer tissue, human placenta tissue, human tonsillitis tissue, mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information Proliferating Cell Nuclear Antigen, commonly known as PCNA, is a protein that acts as a processivity factor for DNA polymerase δ in eukaryotic cells. This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. PCNA induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. It has to be loaded onto DNA in order to be able to stimulate APEX2. PCNA protein is highly conserved during evolution; the deduced amino acid sequences of rat and human differ by only 4 of 261 amino acids. PCNA has been used as loading control for proliferating cells. The calculated molecular weight of PCNA is 29 kDa, but modified PCNA is 36kDa (PMID: 1358458). Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat, pig, rabbit, zebrafish Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7416 Product name: Recombinant human PCNA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 8-256 aa of BC000491 Sequence: QGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIE Predict reactive species Full Name: proliferating cell nuclear antigen Calculated Molecular Weight: 29 kDa/31 kDa Observed Molecular Weight: 36-38 kDa GenBank Accession Number: BC000491 Gene Symbol: PCNA Gene ID (NCBI): 5111 RRID: AB_2236728 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P12004 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.