Proteintech, 60113-1-Ig, SERPINA10 Monoclonal antibody

Size: 20ul / 150ul The SERPINA10 (60113-1-Ig) by Proteintech is a Monoclonal antibody targeting SERPINA10 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, rat, pig samples 60113-1-Ig targets SERPINA10 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, rat, pig samples. Tested Applications Positive WB detected in: HepG2 cells, L02 cells, pig liver tissue, rat liver tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human liver tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1500-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information SERPINA10 belongs to the serpin family. It is predominantly expressed in the liver and secreted in plasma. It inhibits the activity of coagulation factors Xa and XIa in the presence of protein Z, calcium and phospholipid. Mutations in this gene are associated with venous thrombosis. Specification Tested Reactivity: human, rat, pig Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag2420 Product name: Recombinant human SERPINA10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 137-444 aa of BC022261 Sequence: KPGLLPSLFKGLRETLSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYINKETRGKIPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFASTFDKNFRCHVLKLPYQGNATMLVVLMEKMGDHLALEDYLTTDLVETWLRNMKTRNMEVFFPKFKLDQKYEMHELLRQMGIRRIFSPFADLSELSATGRNLQVSRVLQRTVIEVDERGTEAVAGILSEITAYSMPPVIKVDRPFHFMIYEETSGMLLFLGRVVNPTLL Predict reactive species Full Name: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10 Calculated Molecular Weight: 444 aa, 51 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC022261 Gene Symbol: SERPINA10 Gene ID (NCBI): 51156 RRID: AB_2301526 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UK55 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.