Iright
BRAND / VENDOR: Proteintech

Proteintech, 60117-2-Ig, NR2F6 Monoclonal antibody

CATALOG NUMBER: 60117-2-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NR2F6 (60117-2-Ig) by Proteintech is a Monoclonal antibody targeting NR2F6 in WB, IHC, ELISA applications with reactivity to human, rat samples 60117-2-Ig targets NR2F6 in WB, IHC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HCT 116 cells, HeLa cells, HT-29 cells, LNCaP cells, MCF-7 cells, HEK-293 cells, K-562 cells, HSC-T6 cells Positive IHC detected in: human ovary tumor tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NR2F6 belongs to NR2F subfamily members, which have their roles in the regulation of neurogenesis, organogenesis, and cellular differentiation during embryonic development (PMID:15875024). NR2F6 acts as transcription factor by binding to a TGACCT direct-repeat motif and has been established in controlling facets of central nervous system (CNS) (PMID: 12690040). It is a nuclear attenuator that directly interferes with DNA binding of NF-AT and, subsequently, transcriptional activity of the NF-AT-dependent IL-17 expression. Otherwise, NR2F6 negatively interfered with transcriptional cytokine responses and acted as a barrier against autoimmunity (PMID:18701084). Specification Tested Reactivity: human, rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7614 Product name: Recombinant human NR2F6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-404 aa of BC002669 Sequence: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVAASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ Predict reactive species Full Name: nuclear receptor subfamily 2, group F, member 6 Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC002669 Gene Symbol: NR2F6 Gene ID (NCBI): 2063 RRID: AB_2155653 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P10588 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924