Iright
BRAND / VENDOR: Proteintech

Proteintech, 60128-1-Ig, RENALASE Monoclonal antibody

CATALOG NUMBER: 60128-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RENALASE (60128-1-Ig) by Proteintech is a Monoclonal antibody targeting RENALASE in WB, IHC, ELISA applications with reactivity to human samples 60128-1-Ig targets RENALASE in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: OS-RC-2 cells, A431 cells, MG-63 cells, ACHN cells, Caki-1 cells Positive IHC detected in: human kidney tissue, human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information RNLS, also named as Renalase, C10orf59 and MAO-C, belongs to the renalase family. It is probable FAD-dependent amine oxidase secreted by the kidney, which circulates in blood and modulates cardiac function and systemic blood pressure. RNLS degrades catecholamines such as dopamine, norepinephrine and epinephrine in vitro. It lowers blood pressure in vivo by decreasing cardiac contractility and heart rate and preventing a compensatory increase in peripheral vascular tone, suggesting a causal link to the increased plasma catecholamine and heightened cardiovascular risk. High concentrations of catecholamines activate plasma renalase and promotes its secretion and synthesis. RNLS has physiologically relevant catecholamine-oxidizing activity. (PMID:15841207 ) This antibody is specific to RNLS. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag13061 Product name: Recombinant human RENALASE protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-342 aa of BC005364 Sequence: MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKADDSGGRMTTACSPHNPQCTADLGAQYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINLRDDKWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFVSIDNKKRNIESSEIGPSLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQVTNAAANCPGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNYI Predict reactive species Full Name: chromosome 10 open reading frame 59 Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC005364 Gene Symbol: RENALASE Gene ID (NCBI): 55328 RRID: AB_2034903 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q5VYX0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924