Iright
BRAND / VENDOR: Proteintech

Proteintech, 60131-1-Ig, Neudesin/NENF Monoclonal antibody

CATALOG NUMBER: 60131-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Neudesin/NENF (60131-1-Ig) by Proteintech is a Monoclonal antibody targeting Neudesin/NENF in WB, IHC, IF/ICC, ELISA applications with reactivity to human, pig samples 60131-1-Ig targets Neudesin/NENF in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: HeLa cells, human brain tissue, HepG2 cells, LNCaP cells, A549 cells, HCT 116 cells, Jurkat cells, pig brain tissue Positive IHC detected in: human cerebellum tissue, human colon tissue, human colon cancer tissue, human heart tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:20-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information Neudesin neurotrophic factor (NENF, also known as CIR2, SPUF, and SCIRP10) acts as a neurotrophic factor in postnatal mature neurons enhancing neuronal survival, which is localized to mitochondria and endoplasmic reticulum by PINK1 and PARK7 (PMID: 31536960). NENF in the adult brain is expected to play roles in the maintenance and protection of neurons in an autocrine/paracrine manner (PMID: 15605373). It greatly increases cAMP levels in neural precursor cells and might activate a Gs-protein-coupled receptor that could activate the MAPK, PKA, and PI-3K signal pathways (PMID: 16547973). Specification Tested Reactivity: human, pig Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8387 Product name: Recombinant human NENF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 33-172 aa of BC008823 Sequence: QTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIVGYTARRILNEDGSPNLDFKPEDQPHFDIKDEF Predict reactive species Full Name: neuron derived neurotrophic factor Calculated Molecular Weight: 172 aa, 19 kDa Observed Molecular Weight: 19 kDa, 16 kDa GenBank Accession Number: BC008823 Gene Symbol: NENF Gene ID (NCBI): 29937 RRID: AB_2150987 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UMX5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924