Proteintech, 60152-1-Ig, FGF12 Monoclonal antibody

Size: 20ul / 150ul The FGF12 (60152-1-Ig) by Proteintech is a Monoclonal antibody targeting FGF12 in WB, FC (Intra), ELISA applications with reactivity to human samples 60152-1-Ig targets FGF12 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: mouse brain tissue, human brain tissue, rat brain tissue Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension Background Information FGF12 is a member of the fibroblast growth factor (FGF) family. FGF family members play important roles in embryogenesis, angiogenesis, and wound repair. FGF12 lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted. FGF12 plays an intracellular role in the inhibition of radiation-induced apoptosis. FGF12 is expressed abundantly in developing and adult nervous systems; therefore, FGF12 was thought to be related to nervous system development and function. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5046 Product name: Recombinant human FGF12 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-181 aa of BC022524 Sequence: MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREQSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST Predict reactive species Full Name: fibroblast growth factor 12 Calculated Molecular Weight: 181 aa, 20 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC022524 Gene Symbol: FGF12 Gene ID (NCBI): 2257 RRID: AB_10644325 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P61328 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.