Proteintech, 60154-1-Ig, SMN (Human-Specific) Monoclonal antibody

Size: 20ul / 150ul The SMN (Human-Specific) (60154-1-Ig) by Proteintech is a Monoclonal antibody targeting SMN (Human-Specific) in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples 60154-1-Ig targets SMN (Human-Specific) in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A375 cells, Raji cells, HepG2 cells, HEK-293 cells, Jurkat cells Positive IP detected in: HEK-293 cells Positive IHC detected in: mouse kidney tissue, human colon cancer, human heart tissue, human kidney tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information The survival of motor neurons (SMN) genes are the disease genes of spinal muscular atrophy (SMA), a common motor neuron degenerative disease. The level of SMN protein correlates with phenotypic severity of SMA. SMA patients lack a functional SMN1 gene, but they possess an intact SMN2 gene, which though nearly identical to SMN1, is only partially functional, because a large majority of SMN2 transcripts lack exon 7, resulting in production of a truncated, less stable SMN protein. This antibody 60154-1-Ig is specific to human SMN2. It can't recognize mouse and rat SMN. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag14333 Product name: Recombinant human SMN2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-282 aa of BC000908 Sequence: MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMEMLA Predict reactive species Full Name: survival of motor neuron 2, centromeric Calculated Molecular Weight: 282 aa, 30 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC000908 Gene Symbol: SMN Gene ID (NCBI): 6607 RRID: AB_10639513 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q16637 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.