Proteintech, 60180-2-Ig, CD34 Monoclonal antibody

Size: 20ul / 150ul The CD34 (60180-2-Ig) by Proteintech is a Monoclonal antibody targeting CD34 in WB, IHC, ELISA applications with reactivity to human samples 60180-2-Ig targets CD34 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue, human ovary cancer cells, human uterus tissue, human testis tissue Positive IHC detected in: human tonsillitis tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:5000-1:20000 Background Information CD34 is a 105- to 120-kDa glycophosphoprotein expressed on the majority of hematopoietic stem/progenitor cells, bone marrow stromal cells, capillary endothelial cells, embryonic fibroblasts, and some nerve tissue. CD34 is a commonly used marker for identifying human hematopoietic stem/progenitor cells and mediates cell adhesion and lymphocyte homing by binding L-selectin and E-selectin ligands. CD34 is also one of the best negative selection markers for characterizing and/or isolating human MSCs from bone marrow and other sources. Along with other positive selection markers (such as CD29, CD44, CD90, CD105 and CD166), negative selection markers (such as CD34 and CD45) are used for MSC identification. The calculated molecular mass of human CD34 is 41 kDa, various forms with different molecular weights may be produced due to different glycosylation patterns and alternative splicing (PMID: 24375067; 15750786). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5996 Product name: Recombinant human CD34 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 34-287 aa of BC039146 Sequence: DNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYS Predict reactive species Full Name: CD34 molecule Calculated Molecular Weight: 41 kDa Observed Molecular Weight: 105 kDa GenBank Accession Number: BC039146 Gene Symbol: CD34 Gene ID (NCBI): 947 RRID: AB_2881354 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P28906 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.