Iright
BRAND / VENDOR: Proteintech

Proteintech, 60186-1-Ig, Cyclin D1 Monoclonal antibody

CATALOG NUMBER: 60186-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Cyclin D1 (60186-1-Ig) by Proteintech is a Monoclonal antibody targeting Cyclin D1 in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 60186-1-Ig targets Cyclin D1 in WB, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, A549 cells, HeLa cells, NIH/3T3 cells, RAW 264.7 cells, A431 cells, SW 1990 cells, HepG2 cells, U2OS cells, HCT 116 cells, SK-N-SH cells, HSC-T6 cells, PC-12 cells Positive FC (Intra) detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CCND1 (cyclin D1), also known as PRAD1 or BCL1, belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance throughout the cell cycle. CCND1 forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. The CCND1 gene, located on 11q13 has been reported to be overexpressed in mantle cell lymphoma (MCL) due to the chromosomal translocation. CCND1 has been shown to interact with tumor suppressor protein Rb and the expression of this gene is regulated positively by Rb. Over-expression of CCND1 is known to correlate with the early onset of cancer and risk of tumor progression and metastasis. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, rabbit, chicken, zebrafish, bovine, hamster, goat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0689 Product name: Recombinant human Cyclin D1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 65-245 aa of BC000076 Sequence: LEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLR Predict reactive species Full Name: cyclin D1 Calculated Molecular Weight: 295 aa, 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC000076 Gene Symbol: Cyclin D1 Gene ID (NCBI): 595 RRID: AB_10793718 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P24385 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924