Proteintech, 60192-1-Ig, TNFR1/CD120a Monoclonal antibody

Size: 20ul / 150ul The TNFR1/CD120a (60192-1-Ig) by Proteintech is a Monoclonal antibody targeting TNFR1/CD120a in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples 60192-1-Ig targets TNFR1/CD120a in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: pig brain tissue, A549 cells, Daudi cells, HL-60 cells, HeLa cells, rabbit brain tissue, rat brain tissue, mouse brain tissue Positive IHC detected in: human liver cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human liver cancer tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Tumor necrosis factor (TNF) is a multifunctional cytokine that plays a key role in regulating inflammation, immune functions, host defense, and apoptosis (PMID: 16407280). TNF exists in soluble and membrane-bound forms. TNF signals through two distinct cell surface receptors, TNFR1 (TNFRSF1A, CD120a) and TNFR2 (TNFRSF1B, CD120b). Whereas TNFR1 is widely expressed, expression of TNFR2 is limited to cells of the immune system, endothelial cells, and nerve cells (PMID: 22053109). TNFR1, which contains a death domain (DD) within its intracytoplasmic region, is thought to be the key receptor for TNF signaling (PMID: 16407280). This receptor can activate NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag16112 Product name: Recombinant human TNFR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 235-455 aa of BC010140 Sequence: RYQRWKSKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFTPTLGFSPVPSSTFTSSSTYTPGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQSLDTDDPATLYAVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLELLGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR Predict reactive species Full Name: tumor necrosis factor receptor superfamily, member 1A Calculated Molecular Weight: 455 aa, 50 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC010140 Gene Symbol: TNFR1 Gene ID (NCBI): 7132 RRID: AB_10897160 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P19438 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.