Proteintech, 60221-1-Ig, IL-20RB Monoclonal antibody

Size: 20ul / 150ul The IL-20RB (60221-1-Ig) by Proteintech is a Monoclonal antibody targeting IL-20RB in WB, ELISA applications with reactivity to human samples 60221-1-Ig targets IL-20RB in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, MCF-10A cells, A375 cells, hTERT-RPE1 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Interleukin-20 receptor subunit beta (IL20RB) is a single-pass type I membrane protein of the type II cytokine receptor family. The interleukin-20-receptor I complex (IL-20-RI) is composed of two chains, IL20RA and IL20RB. IL-20-RI is a receptor for IL-19, IL-20 and IL-24. IL20RB can also form a heterodimer with IL22RA1. The IL22RA1/IL20RB dimer is a receptor for IL20 and IL24. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag14368 Product name: Recombinant human IL-20RB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-147 aa of BC033292 Sequence: MKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEERPFPWYWPCLPLLASC Predict reactive species Full Name: interleukin 20 receptor beta Calculated Molecular Weight: 311 aa, 35 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC033292 Gene Symbol: IL-20RB Gene ID (NCBI): 53833 RRID: AB_11182930 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q6UXL0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.