Proteintech, 60222-1-Ig, SMMHC Monoclonal antibody

Size: 20ul / 150ul The SMMHC (60222-1-Ig) by Proteintech is a Monoclonal antibody targeting SMMHC in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 60222-1-Ig targets SMMHC in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: rabbit stomach tissue, human ileum tissue, rat rectum tissue, HeLa cells, rabbit large intestine, pig stomach, pig rectum, rat colon, mouse colon Positive IHC detected in: human breast hyperplasia tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:20000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information SMMHC (smooth muscle myosin heavy chain; MYH11) is a contractile protein of smooth muscle cells. It is specifically expressed in cells derived from smooth muscle lineages. SMMHC is used as vascular smooth muscle cell (vSMC) contractile marker. It is also an excellent marker for myoepithelial cells, with no or few cross-reaction with myofibroblasts, thus very useful in the evaluation of stromal invasion. Specification Tested Reactivity: human, mouse, rat, pig, rabbit Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag13397 Product name: Recombinant human MYH11 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-351 aa of BC101677 Sequence: MAQKGQLSDDEKFLFVDKNFINSPVAQADWAAKRLVWVPSEKQGFEAASIKEEKGDEVVVELVENGKKVTVGKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGLFCVVVNPYKHLPIYSEKIVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKDTSITGELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQARDERTFHIFYYMIAGAKEKMRSDLLLEGFNNYTFLSNGFVPIPAAQDDEMFQETVEAMAIMGFSEEEQLSILKVVS Predict reactive species Full Name: myosin, heavy chain 11, smooth muscle Calculated Molecular Weight: 1938 aa, 224 kDa Observed Molecular Weight: 220 kDa GenBank Accession Number: BC101677 Gene Symbol: SMMHC/MYH11 Gene ID (NCBI): 4629 RRID: AB_11182594 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P35749 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.