Proteintech, 60227-1-Ig, IFT88 Monoclonal antibody

Size: 20ul / 150ul The IFT88 (60227-1-Ig) by Proteintech is a Monoclonal antibody targeting IFT88 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 60227-1-Ig targets IFT88 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Human testis, tissue Positive IP detected in: PC-3 cells Positive IHC detected in: human kidney tissue, human heart tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Intraflagellar transport (IFT), mediated by molecular motors and IFT particles, is an important transport process that occurs in the cilium and has been shown to be essential for the assembly and maintenance of cilia and flagella in many organisms. IFT88 (intraflagellar transport protein 88; also known as TG737 or TTC10) is a component of IFT particles and required for cilium biogenesis. Defects in IFT88/Tg737 lead to polycystic kidney disease (11062270). IFT88 localizes to spindle poles during mitosis and is required for spindle orientation in mitosis (21441926). This antibody was raised against the C-terminal region of human IFT88 and can detect the endogenous level of IFT88. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4980 Product name: Recombinant human IFT88 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 532-833 aa of BC030776 Sequence: NIGLTYEKLNRLDEALDCFLKLHAILRNSAEVLYQIANIYELMENPSQAIEWLMQVVSVIPTDPQVLSKLGELYDRGGDKSQAFQYYYESYRYFPCNIEVIEWLGAYYIDTQFWEKAIQYFERASLIQPTQVKWQLMVASCFRRSGNYQKALDTYKDTHRKFPENVECLRFLVRLCTDLGLKDAQEYARKLKRLEKMKEIREQRIKSGRDGSGGSRGKREGSASGDSGQNYSASSKGERLSARLRALPGTNEPYESSSNKEIDASYVDPLGPQIERPKTAAKKRIDEDDFADEELGDDLLPE Predict reactive species Full Name: intraflagellar transport 88 homolog (Chlamydomonas) Calculated Molecular Weight: 94 kDa Observed Molecular Weight: 88-95 kDa GenBank Accession Number: BC030776 Gene Symbol: IFT88 Gene ID (NCBI): 8100 RRID: AB_11042449 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q13099 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.