Proteintech, 60229-1-Ig, Myosin Light Chain 2/MLC-2V Monoclonal antibody

Size: 20ul / 150ul The Myosin Light Chain 2/MLC-2V (60229-1-Ig) by Proteintech is a Monoclonal antibody targeting Myosin Light Chain 2/MLC-2V in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 60229-1-Ig targets Myosin Light Chain 2/MLC-2V in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: human heart tissue, pig heart tissue, rat heart tissue, rabbit heart tissue Positive IHC detected in: mouse heart tissue, human heart tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: C2C12 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information MYL2, also named as MLC-2v and MLC-2, is ventricular/cardiac muscle isoform. Defects in MYL2 are the cause of cardiomyopathy familial hypertrophic type 10 (CMH10). Defects in MYL2 are the cause of cardiomyopathy familial hypertrophic with mid-left ventricular chamber type 2 (MVC2). MYL2 has been widely used as a marker of mature ventricular cardiomyocytes. Specification Tested Reactivity: human, mouse, rat, pig, rabbit Cited Reactivity: human, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag1356 Product name: Recombinant human MYL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC015821 Sequence: MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD Predict reactive species Full Name: myosin, light chain 2, regulatory, cardiac, slow Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC015821 Gene Symbol: Myosin Light Chain 2 Gene ID (NCBI): 4633 RRID: AB_2881356 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P10916 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.