Iright
BRAND / VENDOR: Proteintech

Proteintech, 60237-1-Ig, COTL1 Monoclonal antibody

CATALOG NUMBER: 60237-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The COTL1 (60237-1-Ig) by Proteintech is a Monoclonal antibody targeting COTL1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 60237-1-Ig targets COTL1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, fetal human brain tissue, human peripheral blood platelets, HeLa cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information COTL1, also named as CLP, binds to F-actin in a calcium-independent manner. And it has no direct effect on actin depolymerization. Specification Tested Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag1230 Product name: Recombinant human COTL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC010884 Sequence: MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE Predict reactive species Full Name: coactosin-like 1 (Dictyostelium) Calculated Molecular Weight: 16 kDa Observed Molecular Weight: 14-16 kDa GenBank Accession Number: BC010884 Gene Symbol: COTL1 Gene ID (NCBI): 23406 RRID: AB_2881360 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q14019 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924