Proteintech, 60245-1-Ig, IL-17F Monoclonal antibody

Size: 20ul / 150ul The IL-17F (60245-1-Ig) by Proteintech is a Monoclonal antibody targeting IL-17F in WB, ELISA applications with reactivity to human samples 60245-1-Ig targets IL-17F in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information The interleukin 17 (IL-17) family of cytokines contains 6 structurally related cytokines, IL-17A, IL-17B, IL-17C, IL-17D, IL-17E and IL-17F. IL-17 family plays crucial roles in host defense against microbial organisms and in the development of inflammatory diseases. IL-17A is a pro-inflammatory cytokine that also has the capacity to promote angiogenesis and osteoclastogenesis. IL-17F shares the highest homology with IL-17A and signals via a receptor composed by the IL-17RA and IL-17RC subunits. IL-17A and IL-17F can form IL-17A/A or IL-17F/F homodimers, IL-17A/F heterodimers are also formed. IL-17A and IL-17F, produced by the Th17 CD4(+) T cell lineage, have been linked to a variety of inflammatory and autoimmune conditions. IL-17F levels are elevated in sera and lesional psoriatic skin compared to non-lesional tissue. IL-17F also has been implicated in the development of neutrophilic airway inflammation. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag16310 Product name: Recombinant human IL-17F protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-163 aa of BC070124 Sequence: MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ Predict reactive species Full Name: interleukin 17F Calculated Molecular Weight: 163 aa, 18 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC070124 Gene Symbol: IL-17F Gene ID (NCBI): 112744 RRID: AB_2881367 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q96PD4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.