Proteintech, 60246-1-Ig, 4EBP1 Monoclonal antibody

Size: 20ul / 150ul The 4EBP1 (60246-1-Ig) by Proteintech is a Monoclonal antibody targeting 4EBP1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, pig samples 60246-1-Ig targets 4EBP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: K-562 cells, HCT 116 cells, K562, NCI-H1299 cells Positive IHC detected in: human pancreas cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information Eukaryotic translation initiation factor 4E-binding protein 1(4EBP1), is a member of 4EBPs family, which regulate the translation of a subset of mRNA by competing with eIF4G for binding to eIF4E, thus preventing the assembly of the eIF4F complex. The eIF4F facilitates the recruitment of other translation initiation factors to form the complex and then initiates cap-dependent translation.4EBP1 also mediates the regulation of protein translation by growth factors, hormones and other stimuli that signal through the MAP kinase and mTORC1 pathways. There are three forms of 4EBP1, alpha, beta and gamma.typical pattern seen on Western blots for phosphorylated heat-acid stabled protein 4EBP1 from rat gastrocnemius muscle. Three distinct bands are noted, with the most rapidly migrating band having an apparent molecular mass of ; 20 kDa and the slowest migrating band of; 24 kDa. The 3 bands are designated by convention as alpha, beta and gamma. (PMID: 10913029) Specification Tested Reactivity: human, pig Cited Reactivity: human, chicken Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18985 Product name: Recombinant human 4EBP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-118 aa of BC004459 Sequence: MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI Predict reactive species Full Name: eukaryotic translation initiation factor 4E binding protein 1 Calculated Molecular Weight: 118 aa, 12 kDa Observed Molecular Weight: 15-24 kDa GenBank Accession Number: BC004459 Gene Symbol: EIF4EBP1 Gene ID (NCBI): 1978 RRID: AB_2881368 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13541 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.