Proteintech, 60247-1-Ig, Cytokeratin 15 Monoclonal antibody

Size: 20ul / 150ul The Cytokeratin 15 (60247-1-Ig) by Proteintech is a Monoclonal antibody targeting Cytokeratin 15 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 60247-1-Ig targets Cytokeratin 15 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells Positive IHC detected in: human skin cancer tissue, human cervical cancer tissue, mouse skin tissue, rat skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells. Keratin expression is highly regulated, tissue specific, and varies according to cell-state. Type I keratins consist of acidic, low molecular weight proteins with MW ranging from 40 kDa (KRT19) to 64 kDa (KRT9). Type 2 keratins consist of basic or neutral, high molecular weight proteins with MW from 52 kDa (KRT8) to 67 kDa (KRT18). Keratin 15 is a type I cytokeratin. It is found in some progenitor basal cells within complex epithelia. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0185 Product name: Recombinant human KRT15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 238-450 aa of BC002641 Sequence: AYLKKNHEEEMKEFSSQLAGQVNVEMDAAPGVDLTRVLAEMREQYEAMAEKNRRDVEAWFFSKTEELNKEVASNTEMIQTSKTEITDLRRTMQELEIELQSQLSMKAGLENSLAETECRYATQLQQIQGLIGGLEAQLSELRCEMEAQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVS Predict reactive species Full Name: keratin 15 Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 49 kDa GenBank Accession Number: BC002641 Gene Symbol: KRT15 Gene ID (NCBI): 3866 RRID: AB_2881369 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P19012 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.