Proteintech, 60252-1-Ig, MAPK13 Monoclonal antibody

Size: 20ul / 150ul The MAPK13 (60252-1-Ig) by Proteintech is a Monoclonal antibody targeting MAPK13 in WB, IHC, ELISA applications with reactivity to human samples 60252-1-Ig targets MAPK13 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Ramos cells, HepG2 cells, Daudi cells, HEK-293 cells Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Background Information MAPK13(Mitogen-activated protein kinase 13) is also named as PRKM13, SAPK4 and belongs to the protein kinase superfamily. MAPK13 is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli such as proinflammatory cytokines or physical stress leading to direct activation of transcription factors such as ELK1 and ATF2. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag21240 Product name: Recombinant human MAPK13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 307-365 aa of BC000433 Sequence: FFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL Predict reactive species Full Name: mitogen-activated protein kinase 13 Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 38-42 kDa GenBank Accession Number: BC000433 Gene Symbol: MAPK13 Gene ID (NCBI): 5603 RRID: AB_2881373 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O15264 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.