Iright
BRAND / VENDOR: Proteintech

Proteintech, 60266-1-Ig, KIFAP3 Monoclonal antibody

CATALOG NUMBER: 60266-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The KIFAP3 (60266-1-Ig) by Proteintech is a Monoclonal antibody targeting KIFAP3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 60266-1-Ig targets KIFAP3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human testis tissue Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information KIFAP3, also known as KIF3AP or KAP3, is a novel KIF3A/3B-associated protein. It binds to the tail domain of KIF3A/3B and may play a role in regulating the binding of KIF3A/3B to cargoes. Recently it has been reported that mutation within the KIFAP3 gene is associated with decreased KIFAP3 expression and increased survival in sporadic ALS, which makes it a potential target for ALS therapy. KIFAP3 has also been identified as the target of mir-130a. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag20809 Product name: Recombinant human KIFAP3 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 491-792 aa of BC028679 Sequence: SQHDGPTKNLFIDYVGDLAAQISNDEEEEFVIECLGTLANLTIPDLDWELVLKEYKLVPYLKDKLKPGAAEDDLVLEVVIMIGTVSMDDSCAALLAKSGIIPALIELLNAQQEDDEFVCQIIYVFYQMVFHQATRDVIIKETQAPAYLIDLMHDKNNEIRKVCDNTLDIIAEYDEEWAKKIQSEKFRWHNSQWLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEGAISPDFFNDYHLQNGDVVGQHSFPGSLGMDGFGQPVGILGRPATAYGFRPDEPYYYGYGS Predict reactive species Full Name: kinesin-associated protein 3 Calculated Molecular Weight: 792 aa, 91 kDa Observed Molecular Weight: 91-100 kDa GenBank Accession Number: BC028679 Gene Symbol: KIFAP3 Gene ID (NCBI): 22920 RRID: AB_2881387 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q92845 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924