Iright
BRAND / VENDOR: Proteintech

Proteintech, 60269-1-Ig, IL-10 Monoclonal antibody

CATALOG NUMBER: 60269-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The IL-10 (60269-1-Ig) by Proteintech is a Monoclonal antibody targeting IL-10 in WB, IF/ICC, ELISA applications with reactivity to human samples 60269-1-Ig targets IL-10 in WB, IHC, IF/ICC, ELISA, Cell treatment applications and shows reactivity with human samples. Tested Applications Positive WB detected in: ag14870 Positive IF/ICC detected in: MOLT-4 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Interleukin (IL)-10 is an anti-inflammatory cytokine, produced by T helper (Th) cells, macrophages, monocytes, and B cells, that plays a crucial role in preventing inflammatory and autoimmune pathologies. It downregulates the expression of Th1 cytokines, MHC class II antigens, and co-stimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. IL-10 can block NF-κB activity, and is involved in the regulation of the JAK-STAT signaling pathway. IL-10, along with its receptors, describes an important role in pathogenesis of various diseases, including infectious, inflammatory, autoimmune diseases. IL-10 mutations are associated with an increased susceptibility to HIV-1 infection and rheumatoid arthritis. Specification Tested Reactivity: human Cited Reactivity: human, rat, rabbit, zebrafish Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag14870 Product name: Recombinant human IL-10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 19-178 aa of BC104252 Sequence: SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN Predict reactive species Full Name: interleukin 10 Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC104252 Gene Symbol: IL-10 Gene ID (NCBI): 3586 RRID: AB_2881389 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P22301 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924