Proteintech, 60280-1-Ig, FABP3 Monoclonal antibody

Size: 20ul / 150ul The FABP3 (60280-1-Ig) by Proteintech is a Monoclonal antibody targeting FABP3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 60280-1-Ig targets FABP3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human heart tissue, rat heart, mouse heart Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1900-1:7600 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information FABP3 (fatty-acid-binding protein 3), also known as heart-type FABP or mammary-derived growth inhibitor (MDGI), is a small 15-kDa cytoplasmic protein transporting fatty acids and other lipophilic substances from the cytoplasm to the nucleus. It is most ubiquitously expressed in heart and skeletal muscle. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag21483 Product name: Recombinant human FABP3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-133 aa of BC007021 Sequence: MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA Predict reactive species Full Name: fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) Calculated Molecular Weight: 15 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC007021 Gene Symbol: FABP3 Gene ID (NCBI): 2170 RRID: AB_2881398 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P05413 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.