Iright
BRAND / VENDOR: Proteintech

Proteintech, 60281-1-Ig, SECTM1 Monoclonal antibody

CATALOG NUMBER: 60281-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SECTM1 (60281-1-Ig) by Proteintech is a Monoclonal antibody targeting SECTM1 in WB, IHC, ELISA applications with reactivity to human samples 60281-1-Ig targets SECTM1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HaCaT cells, JAR cells, NCCIT cells, PC-3 cells, LNCaP cells, HeLa cells, K-562 cells Positive IHC detected in: human breast cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SECTM1, also named as protein K12, is originally identified by its location just upstream of the CD7 locus. It has been proposed as a ligand for CD7. SECTM1 is involved in thymocyte signaling. This antibody is specific to SECTM1. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgM Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag14645 Product name: Recombinant human SECTM1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 29-248 aa of BC017716 Sequence: QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAVFILLVALVMFAWYRCRCSQQRREKKFFLLEPQMKFAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPSPLGALELLSPQPLFPYAADP Predict reactive species Full Name: secreted and transmembrane 1 Calculated Molecular Weight: 248 aa, 27 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC017716 Gene Symbol: SECTM1 Gene ID (NCBI): 6398 RRID: AB_2881399 Conjugate: Unconjugated Form: Liquid Purification Method: Thiophilic affinity chromatograph UNIPROT ID: Q8WVN6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924