Proteintech, 60288-2-Ig, Annexin A4 Monoclonal antibody

Size: 20ul / 150ul The Annexin A4 (60288-2-Ig) by Proteintech is a Monoclonal antibody targeting Annexin A4 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 60288-2-Ig targets Annexin A4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells, human placenta tissue, A549 cells, human heart tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Annexin A4 (Anxa4) is one of the Ca2 +-regulated and phospholipid-binding annexin superfamily proteins, and is located at 2p13. Anxa4 has a potential role in diagnosis, prognosis, and treatment of certain cancers. Annexin A4 shares 45 to 59% identity with other members and possibly interacts with ATP. Annexin A4 has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. The Annexin A4 protein is expressed in a wide range of tissues, associated with polarized epithelial cells and is proposed to be involved in the regulation of chloride ions across the epithelial membrane. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2c Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0130 Product name: Recombinant human Annexin IV protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 33-202 aa of BC000182 Sequence: GTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSR Predict reactive species Full Name: annexin A4 Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC000182 Gene Symbol: Annexin A4 Gene ID (NCBI): 307 RRID: AB_2881405 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P09525 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.