Iright
BRAND / VENDOR: Proteintech

Proteintech, 60290-1-Ig, IL-36 Beta/IL-1F8 Monoclonal antibody

CATALOG NUMBER: 60290-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The IL-36 Beta/IL-1F8 (60290-1-Ig) by Proteintech is a Monoclonal antibody targeting IL-36 Beta/IL-1F8 in WB, IHC, IF-P, ELISA applications with reactivity to human samples 60290-1-Ig targets IL-36 Beta/IL-1F8 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Recombinant protein Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12675 Product name: Recombinant human IL-1F8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-157 aa of BC101833 Sequence: MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE Predict reactive species Full Name: interleukin 1 family, member 8 (eta) Calculated Molecular Weight: 157 aa, 18 kDa Observed Molecular Weight: 44 kDa GenBank Accession Number: BC101833 Gene Symbol: IL-36 Beta/IL-1F8 Gene ID (NCBI): 27177 RRID: AB_2881406 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9NZH7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924