Proteintech, 60300-3-Ig, PTEN Monoclonal antibody

Size: 20ul / 150ul The PTEN (60300-3-Ig) by Proteintech is a Monoclonal antibody targeting PTEN in WB, ELISA applications with reactivity to human, mouse samples 60300-3-Ig targets PTEN in WB, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, DU 145 cells, HT-29 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Background Information PTEN (also designated MMAC1), products of tumor suppressor genes, are found deleted in most human gliomas. The PTEN genes are also mutated in many other tumors, such as brain, breast, kidney and prostate cancers. PTEN is a protein tyrosine phosphatase that may terminate the signaling transduction pathways mediated by PI 3-kinase/Akt. PTEN has an apparent molecular weight of 55 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17274 Product name: Recombinant human PTEN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 204-403 aa of BC005821 Sequence: PMFSGGTCNPQFVVCQLKVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEASSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHTQITK Predict reactive species Full Name: phosphatase and tensin homolog Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC005821 Gene Symbol: PTEN Gene ID (NCBI): 5728 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P60484 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.