Proteintech, 60301-1-Ig, BID Monoclonal antibody

Size: 20ul / 150ul The BID (60301-1-Ig) by Proteintech is a Monoclonal antibody targeting BID in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 60301-1-Ig targets BID in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:200-1:1800 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information BID, also named as p22 BID, can be cleaved into p11 BID, p13 BID and p15 BID. It is pro-apoptotic molecules. The major proteolytic product p15 BID allows the release of cytochrome c. BID-L, BID-EL and BID-ES induce ICE-like proteases and apoptosis. BID-S does not induce apoptosis. BID counters the protective effect of Bcl-2. (PMID:14583606). Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag21005 Product name: Recombinant human BID protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-195 aa of BC009197 Sequence: MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD Predict reactive species Full Name: BH3 interacting domain death agonist Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC009197 Gene Symbol: BID Gene ID (NCBI): 637 RRID: AB_2881416 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P55957 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.