Iright
BRAND / VENDOR: Proteintech

Proteintech, 60303-1-Ig, SIRT1 Monoclonal antibody

CATALOG NUMBER: 60303-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SIRT1 (60303-1-Ig) by Proteintech is a Monoclonal antibody targeting SIRT1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 60303-1-Ig targets SIRT1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, Hek-293 cells, LNCaP cells, Jurkat cells, MCF-7 cells Positive IP detected in: HeLa cells Positive IHC detected in: human breast cancer tissue, human testis tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: BT-549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000 Background Information SIRT1, also named as SIR2L1, contains a deacetylase sirtuin-type domain and belongs to the sirtuin family. The post-translation modified SIRT1 is a 110-130 kDa protein, which contains one deacetylase sirtuin-type domain. The 75-80 kDa SIRT1 fragment was detected to lack the carboxy-terminus (PMID:21305533). SIRT1 exists a 57-61 kDa isoform. SIRT1 may be found in nucleolus, nuclear euchromatin, heterochromatin and inner membrane. It can shuttles between nucleus and cytoplasm. SIRT1 regulates processes such as apoptosis and muscle differentiation by deacetylating key proteins. SIRT1 in particular initiates several signaling events relevant to cardioprotection, including: activation of endothelial nitric oxide synthase, INS receptor signaling, and autophagy. In addition SIRT1 activation elicits resistance to oxidative stress via regulation of transcription factors and co-activators such as FOXO, Hif-2a, and NF-kB. SIRT1 regulates the p53-dependent DNA damage response pathway by binding to and deacetylating p53, specifically at Lysine 382. Specification Tested Reactivity: human Cited Reactivity: human, pig, rabbit Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17677 Product name: Recombinant human SIRT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC012499 Sequence: MIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGALFSQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPE Predict reactive species Full Name: sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae) Calculated Molecular Weight: 747 aa, 82 kDa Observed Molecular Weight: 110-130 kDa GenBank Accession Number: BC012499 Gene Symbol: SIRT1 Gene ID (NCBI): 23411 RRID: AB_2881417 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96EB6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924