Iright
BRAND / VENDOR: Proteintech

Proteintech, 60307-1-Ig, FOLR1 Monoclonal antibody

CATALOG NUMBER: 60307-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FOLR1 (60307-1-Ig) by Proteintech is a Monoclonal antibody targeting FOLR1 in WB, IHC, ELISA applications with reactivity to human samples 60307-1-Ig targets FOLR1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human milk, HeLa cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Folate receptor 1 (FOLR1), also known as folate receptor alpha or adult folate-binding protein (FBP), is a 38-kDa glycoprotein belonging to the folate receptor family (PMID:15094207; 23528302). The receptor binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. FOLR1 is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form. FOLR1 expression is often limited to the apical surfaces of epithelium in the lung, kidney and choroid plexus but is differentially overexpressed in a variety of solid tumors such as ovarian cancer, non-small cell lung cancer, breast cancer, kidney cancer and high-grade osteosarcoma (PMID: 23528302; 23357463). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19959 Product name: Recombinant human FOLR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 55-93 aa of BC002947 Sequence: EQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMA Predict reactive species Full Name: folate receptor 1 (adult) Calculated Molecular Weight: 257 aa, 30 kDa Observed Molecular Weight: 36-38 kDa GenBank Accession Number: BC002947 Gene Symbol: FOLR1 Gene ID (NCBI): 2348 RRID: AB_2881421 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P15328 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924