Proteintech, 60334-1-Ig, hCG Beta Monoclonal antibody

Size: 20ul / 150ul The hCG Beta (60334-1-Ig) by Proteintech is a Monoclonal antibody targeting hCG Beta in IHC, ELISA applications with reactivity to human samples 60334-1-Ig targets hCG Beta in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Beta-hCG (beta-human chorionic gonadotropin) is a glycoprotein hormone produced by the placenta during pregnancy. It is a critical marker used in both obstetrics and oncology for various diagnostic and monitoring purposes. hCG is composed of two subunits: an alpha subunit (similar to other glycoprotein hormones like LH, FSH, and TSH) and a unique beta subunit (β-hCG). The beta subunit is the primary focus for diagnostic tests due to its specificity. β-hCG is initially secreted by the syncytiotrophoblast cells surrounding the developing embryo and later by the placenta. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag2191 Product name: Recombinant human CGB,hCG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-165 aa of BC022796 Sequence: MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ Predict reactive species Full Name: CG beta Calculated Molecular Weight: 165 aa, 18 kDa GenBank Accession Number: BC022796 Gene Symbol: hCG Beta Gene ID (NCBI): 1082 RRID: AB_2881443 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P0DN86 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.