Proteintech, 60338-1-Ig, KLK3/PSA Monoclonal antibody

Size: 20ul / 150ul The KLK3/PSA (60338-1-Ig) by Proteintech is a Monoclonal antibody targeting KLK3/PSA in WB, IHC, ELISA applications with reactivity to human samples 60338-1-Ig targets KLK3/PSA in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: LNCaP cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:5000-1:20000 Background Information KLK3 also known as Prostate-Specific Antigen (PSA), is a 33 kDa glycoprotein primarily synthesized by the epithelial cells of the prostate gland. Its main physiological function is to cleave seminogelins I and II in semen, leading to the liquefaction of the seminal coagulum and the release of motile sperm. It is under tight regulation by androgens via the androgen receptor (AR). Serum PSA levels are elevated in prostate cancer due to disruption of the glandular architecture, allowing more PSA to enter the bloodstream. It is used alongside digital rectal exam (DRE) for early detection. Although termed "prostate-specific," PSA is not exclusively produced by the prostate. Very low levels can be produced in periurethral glands, breast tissue, and some other tissues. Its expression is highly abundant in prostatic tissue and seminal fluid. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag1060 Product name: Recombinant human KLK3,PSA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-261 aa of BC005307 Sequence: MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP Predict reactive species Full Name: kallikrein-related peptidase 3 Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 30-34 kDa GenBank Accession Number: BC005307 Gene Symbol: KLK3 Gene ID (NCBI): 354 RRID: AB_2881447 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P07288 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.