Proteintech, 60339-1-Ig, CX3CL1 Monoclonal antibody

Size: 20ul / 150ul The CX3CL1 (60339-1-Ig) by Proteintech is a Monoclonal antibody targeting CX3CL1 in WB, IHC, ELISA applications with reactivity to human samples 60339-1-Ig targets CX3CL1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PC-3 cells Positive IHC detected in: human brain tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0161 Product name: Recombinant human CX3CL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 90-245 aa of BC001163 Sequence: DRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLEPEATGESSSLEPTPSSQEAQRALGTSPELPTGVTGSSGTRLPPTPKAQDGGPVGTELFRVPPVSTAATWQSSAPHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENAPSEGQ Predict reactive species Full Name: chemokine (C-X3-C motif) ligand 1 Calculated Molecular Weight: 42 kDa Observed Molecular Weight: 90 kDa GenBank Accession Number: BC001163 Gene Symbol: CX3CL1 Gene ID (NCBI): 6376 RRID: AB_2881448 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P78423 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.