Iright
BRAND / VENDOR: Proteintech

Proteintech, 60343-1-Ig, Prostein Monoclonal antibody

CATALOG NUMBER: 60343-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Prostein (60343-1-Ig) by Proteintech is a Monoclonal antibody targeting Prostein in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 60343-1-Ig targets Prostein in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat testis tissue, JAR cells, mouse testis tissue Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human prostate cancer tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:10000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Prostein is a prostate tissue-specific protein whose expression is highly restricted to normal and cancerous prostate tissues. Anti-prostein is useful for the identification of prostate adenocarcinomas and is a good marker to identify prostatic origin in metastatic cancer. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5463 Product name: Recombinant human SLC45A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 405-553 aa of BC050416 Sequence: REKQVFLPKYRGDTGGASSEDSLMTSFLPGPKPGAPFPNGHVGAGGSGLLPPPPALCGASACDVSVRVVVGEPTEARVVPGRGICLDLAILDSAFLLSQVAPSLFMGSIVQLSQSVTAYMVSAAGLGLVAIYFATQVVFDKSDLAKYSA Predict reactive species Full Name: solute carrier family 45, member 3 Calculated Molecular Weight: 59 kDa Observed Molecular Weight: 55-59 kDa GenBank Accession Number: BC050416 Gene Symbol: Prostein Gene ID (NCBI): 85414 RRID: AB_2881452 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96JT2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924