Proteintech, 60349-1-Ig, BSAP,PAX5 Monoclonal antibody

Size: 20ul / 150ul The BSAP,PAX5 (60349-1-Ig) by Proteintech is a Monoclonal antibody targeting BSAP,PAX5 in WB, IHC, FC (Intra), ELISA applications with reactivity to human samples 60349-1-Ig targets BSAP,PAX5 in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Ramos cells, Daudi cells, Raji cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: Ramos cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information PAX5, also named B-cell specific activator protein (BSAP), is a member of the highly conserved paired box (PAX)-domain family of transcription factors. PAX5 is essential in normal B-cell lymphopoiesis. It is expressed in pro-B, pre-B and mature B lymphocytes but not in plasma cells. PAX5 is a common target in leukemogenesis of B-ALL ( B-lineage acute lymphoblastic leukemia) along with CDKN2A. Owing to its frequent deletion in B-ALL, PAX5 could be used as one of the molecular markers in diagnosis and monitoring of the disease. This antibody is specific to PAX5. It will not cross react with other PAX members. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag16023 Product name: Recombinant human BSAP,PAX5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 145-391 aa of BC156927 Sequence: QPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYYSAAARGAAPPAAATAYDRH Predict reactive species Full Name: paired box 5 Calculated Molecular Weight: 391 aa, 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC156927 Gene Symbol: PAX5 Gene ID (NCBI): 5079 RRID: AB_2881458 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q02548 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.