Iright
BRAND / VENDOR: Proteintech

Proteintech, 60355-1-Ig, TIM3 Monoclonal antibody

CATALOG NUMBER: 60355-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TIM3 (60355-1-Ig) by Proteintech is a Monoclonal antibody targeting TIM3 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples 60355-1-Ig targets TIM3 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: Daudi cells, PC-3 cells, pig thymus tissue, ROS1728 cells, human heart tissue, RAW 264.7 cells, rat heart tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:10000 Background Information TIM3, also known as HAVCR2, is a member of the recently discovered T cell Ig and mucin domain-containing molecule superfamily. TIM3 is a negative regulatory molecule that is important for T cell tolerance and has a crucial role in autoimmunity and T cell exhaustion during chronic viral infection (PMID: 23180819). TIM3 is expressed by T-helper type 1 (Th1) cells, macrophage, monocyte, dendritic cells, CD8+ T cell and other lymphocyte subsets. Galectin-9 is a ligand for TIM3. TIM3-galectin-9 pathway negatively regulates T helper type 1 immunity (PMID: 16286920). TIM3 is a 280-aa membrane protein with a calculated molecular weight of 33 kDa, the higher molecular weights between 50 and 70 kDa detected by this monoclonal antibody probably represent glycosylated TIM3 (PMID: 20107545; 17069754; 11725301). Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag16901 Product name: Recombinant human HAVCR2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-142 aa of BC020843 Sequence: MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPGEWTFACHLYE Predict reactive species Full Name: hepatitis A virus cellular receptor 2 Calculated Molecular Weight: 301 aa, 33 kDa Observed Molecular Weight: 33 kDa, 50-70 kDa GenBank Accession Number: BC020843 Gene Symbol: TIM3 Gene ID (NCBI): 84868 RRID: AB_2881464 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8TDQ0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924