Proteintech, 60442-2-Ig, ATAD1 Monoclonal antibody

Size: 20ul / 150ul The ATAD1 (60442-2-Ig) by Proteintech is a Monoclonal antibody targeting ATAD1 in WB, ELISA applications with reactivity to human, mouse, rat, rabbit samples 60442-2-Ig targets ATAD1 in WB, ELISA applications and shows reactivity with human, mouse, rat, rabbit samples. Tested Applications Positive WB detected in: TT cells, rabbit brain tissue, HeLa cells, HEK-293 cells, rat brain tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information The mitochondrial AAA (ATPase Associated with diverse cellular Activities) protein ATAD1 (in humans; Msp1 in yeast) removes mislocalized membrane proteins, as well as stuck import substrates from the mitochondrial outer membrane, facilitating their re-insertion into their cognate organelles and maintaining mitochondria's protein import capacity. Specification Tested Reactivity: human, mouse, rat, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag10471 Product name: Recombinant human ATAD1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 164-361 aa of BC010868 Sequence: DKWYGESQKLAAAVFSLAIKLQPSIIFIDEIDSFLRNRSSSDHEATAMMKAQFMSLWDGLDTDHSCQVIVMGATNRPQDLDSAIMRRMPTRFHINQPALKQREAILKLILKNENVDRHVDLLEVAQETDGFSGSDLKEMCRDAALLCVREYVNSTSEESHDEDEIRPVQQQDLHRAIEKMKKSKDAAFQNVLTHVCLD Predict reactive species Full Name: ATPase family, AAA domain containing 1 Calculated Molecular Weight: 361 aa, 41 kDa Observed Molecular Weight: 32-37 kDa GenBank Accession Number: BC010868 Gene Symbol: ATAD1 Gene ID (NCBI): 84896 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8NBU5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.