Iright
BRAND / VENDOR: Proteintech

Proteintech, 60556-7-Ig, POT1 Monoclonal antibody

CATALOG NUMBER: 60556-7-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The POT1 (60556-7-Ig) by Proteintech is a Monoclonal antibody targeting POT1 in WB, ELISA applications with reactivity to human samples 60556-7-Ig targets POT1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, MOLT-4 cells, Daudi cells, Karpas-422 cells, Ramos cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Protection of telomeres 1(POT1) is a conserved protein that binds the G-rich stand of its own telomeric repeat sequence, with a role in protecting chromosome ends. It's housekeeping gene that is required to ensure the integrity of chromosome ends in all cells. It's a component of the telomerase ribonucleoprotein(RNP) complex that is esential for the replication of chromosome termini. It consists the TRF1 compex that is involved in the regulation of telomere length by cis-inhibition of telomerase. We have discovered that POT1 exists in at least three consistently occurring forms; 90, 70 and 45kDa. The unexpected molecular weights of POT1 seem to be associated with SUMO1 and ubiquitin conjugation; the latter occurring at a double lysine residue at 289-KK-290 (.PMID: 24054699) Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag36974 Product name: Recombinant human POT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 336-634 aa of BC002923 Sequence: ILTDHQYLERTPLCAILKQKAPQQYRIRAKLRSYKPRRLFQSVKLHCPKCHLLQEVPHEGDLDIIFQDGATKTPDVKLQNTSLYDSKIWTTKNQKGRKVAVHFVKNNGILPLSNECLLLIEGGTLSEICKLSNKFNSVIPVRSGHEDLELLDLSAPFLIQGTIHHYGCKQCSSLRSIQNLNSLVDKTSWIPSSVAEALGIVPLQYVFVMTFTLDDGTGVLEAYLMDSDKFFQIPASEVLMDDDLQKSVDMIMDMFCPPGIKIDAYPWLECFIKSYNVTNGTDNQICYQIFDTTVAEDVI Predict reactive species Full Name: POT1 protection of telomeres 1 homolog (S. pombe) Calculated Molecular Weight: 71 kDa Observed Molecular Weight: 71 kDa GenBank Accession Number: BC002923 Gene Symbol: POT1 Gene ID (NCBI): 25913 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NUX5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924