Proteintech, 60626-1-Ig, CDKN2A/P16-INK4A Monoclonal antibody

Size: 20ul / 150ul The CDKN2A/P16-INK4A (60626-1-Ig) by Proteintech is a Monoclonal antibody targeting CDKN2A/P16-INK4A in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 60626-1-Ig targets CDKN2A/P16-INK4A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SiHa cells, HEK-293 cells, HeLa cells, TF-1 cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:2500-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information P16-INK4A is also named as CDKN2A, MLM, Tumor suppressor ARF, Alternative reading frame. The tumor suppressor protein p16Ink4a (encoded from the CDKN2A locus) is often transcriptionally activated in cells undergoing senescence and is one of the main regulators of this program, and it is upregulated in multiple tissues during aging (PMID:17055429). p16-Ink4a is the principal member of the Ink4 family of CDK inhibitors. p16-Ink4a contributes to the regulation of cell cycle progression by inhibiting the S phase. p16Ink4a binds to CDK4/6, inhibiting cyclin D-CDK4/6 complex formation and CDK4/6-mediated phosphorylation of Rb family members. Expression of p16-Ink4a maintains the Rb family members in a hypophosphorylated state, which promotes binding to E2F1 and leads to G1 cell cycle arrest (PMID: 21297668). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag1328 Product name: Recombinant human P16-INK4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 52-156 aa of BC021998 Sequence: MMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD Predict reactive species Full Name: cyclin-dependent kinase inhibitor 2A Calculated Molecular Weight: 16 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC021998 Gene Symbol: CDKN2A Gene ID (NCBI): 1029 RRID: AB_3670270 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P42771 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.